Scaffold Ga0307406_10010640

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307406_10010640

Scaffold Ga0307406_10010640

Overview

Basic Information
Taxon OID	3300031901 Open in IMG/M
Scaffold ID	Ga0307406_10010640 Open in IMG/M
Source Dataset Name	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5195
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	38.5	Long. (^o)	-121.7	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020991	Metagenome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307406_100106401	F020991	N/A	QGLPVNEAARRRVSRAVRAGEAVTDPADAPAAVELARLAQRRLQDRVLPSALRISGGVTAVWLVLVALPVTVSTGVHPAALAAGVGVGLVLFSVILLLGRRQLHLARRAEQRNLRLLEEDGR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.