| Basic Information | |
|---|---|
| Taxon OID | 3300031886 Open in IMG/M |
| Scaffold ID | Ga0315318_10138046 Open in IMG/M |
| Source Dataset Name | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1371 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 36.7468 | Long. (o) | -122.0193 | Alt. (m) | Depth (m) | 200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000615 | Metagenome / Metatranscriptome | 984 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315318_101380465 | F000615 | N/A | YIMCRIRCFYECSDGDMGFAEMVLSYEDDIAGFVKHWKTGGRMVITEHIDLV |
| ⦗Top⦘ |