| Basic Information | |
|---|---|
| Taxon OID | 3300031885 Open in IMG/M |
| Scaffold ID | Ga0315285_10298374 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1209 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Algavirales → Phycodnaviridae → Prasinovirus → unclassified Prasinovirus → Yellowstone lake phycodnavirus 2 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.508 | Long. (o) | -110.3268 | Alt. (m) | Depth (m) | 93 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F094908 | Metagenome | 105 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315285_102983743 | F094908 | N/A | MGTDIVPTCGGNRYIAEDLSKCMEQLKTRWDNLVNDPAFRRKFTGCQGDYDISKCRRIIHPKGTLYTPVSDEEGHFMAYEFIGSGVIRVFDPAHITSRYSGHLDRNLISKLSGRRVVVCRDHPQKHEEDTFCATWTLAWLRPDLRHVTASWGTRPRPKPSSSQPE |
| ⦗Top⦘ |