Basic Information | |
---|---|
Taxon OID | 3300031877 Open in IMG/M |
Scaffold ID | Ga0315314_1013172 Open in IMG/M |
Source Dataset Name | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Restricted |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5169 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Freshwater Sediment Microbial Communities From Lake Towuti, South Sulawesi, Indonesia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Indonesia: South Sulawesi | |||||||
Coordinates | Lat. (o) | -2.7726 | Long. (o) | 121.4938 | Alt. (m) | Depth (m) | 4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039458 | Metagenome | 163 | Y |
F093178 | Metagenome | 106 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0315314_10131724 | F039458 | GGTGG | LKKTVEEQIKVLFEKYSFPPLEVIIPILEKAGRGEQELTTQVYNTEANLIKGIKEILGLTDKNMRTLAKVMGITLSFEGVKFQPIELTESRFSLSISDCPMLHVGKDVSSSVKSKFCDLICTAGGRAAMDTALGQGRGSCSWDKSLIKGAGKCRLVFELVKTG |
Ga0315314_10131725 | F093178 | GAG | MSYLKNSLLLVSICLVVIGIGFIILWPNMTASMSRADLEAILETTTATFGTMLGIITAGLMFTQAKFSELASELSDKSSDYLAKVLSLEKIQSIENHLIILRKTFTNLAATTTITEERNLYERIATKVSLIFVNLAVLLNLKLKQQGLPDTGLLVSEMDSNLYRVYEKRRSIRKEWHLLNIIKQIVDIWEAPAAFFDEKSKKKSALQTDIKSSISLLELKEKVDKGSTVSSEVKKTLGNLTDELSKVSKRLHEDRIPQLLFQMEQASTLRGKYFYLALIFIAAPLLANLLILPQFSETTLTFFKSIISVTSLLSVMGVIFLLLYIHKILNV |
⦗Top⦘ |