Basic Information | |
---|---|
Taxon OID | 3300031877 Open in IMG/M |
Scaffold ID | Ga0315314_1008973 Open in IMG/M |
Source Dataset Name | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Restricted |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6686 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Freshwater Sediment Microbial Communities From Lake Towuti, South Sulawesi, Indonesia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Indonesia: South Sulawesi | |||||||
Coordinates | Lat. (o) | -2.7726 | Long. (o) | 121.4938 | Alt. (m) | Depth (m) | 4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030967 | Metagenome | 183 | Y |
F104375 | Metagenome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0315314_10089732 | F104375 | GGAGG | LDCPECRGPVVLPDGSSGETVCRKCGLVVTQAVTNEPQFTNWTPKWFSNWDQNDSETLRQWLTTLRIASCQLNLPHFPYTEDAAHVIRLRRDAFFQCQRFGKNKREAVAALIYLILRKYDEIRSLREICERLSLNHHLVKKYAWSMREMTNFGRTYSAKDYLRAYGWKLTRDPGLIKRAERLLAQIHGKISGNPISLAAGAFYLVCRKGKVMISKQDIGKAFHISGRTVYSNERRISRLLSTKGFRLTDILS |
Ga0315314_10089733 | F030967 | GAG | MSAEDLKRLEELENRLQKLEKRGFEDTVTLVEILSSMTFFGGLKMEKCIYAREGQCRLFLLGSDAKKRIPLATDCSIHNCKGEPSHCHLELSNIVCAFCPEAKMTKVRTENR |
⦗Top⦘ |