Scaffold Ga0315297_11414199

Overview

Basic Information

• Taxon OID: 3300031873
• Scaffold ID: Ga0315297_11414199
• Source Dataset Name: Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 564
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.536
  • Long. (^o): -110.4254
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017254	Metagenome / Metatranscriptome	242	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315297_114141991	F017254	N/A	KILTTVLLAWALWWVQDMENKPELPRDIVKLSVHETQAACEAQVATRRQWQVDLSQQEVKSFDWNSKPWPTYMLRRQTFTCIPA