Scaffold Ga0316033_110610

Overview

Basic Information

• Taxon OID: 3300031872
• Scaffold ID: Ga0316033_110610
• Source Dataset Name: Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 metaT (Metagenome Metatranscriptome) (v2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 569
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSLD10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.044
  • Long. (^o): 13.617

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022874	Metagenome / Metatranscriptome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316033_1106102	F022874	N/A	PLALSPMALNAQDHKAVTYHDKEHNDDHEWNSHENQAYKVYTKQNHRKNTTFSKLNDSDQQAYWSWRHEHSDAQLNINIR