NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326511_10884523

Scaffold Ga0326511_10884523


Overview

Basic Information
Taxon OID3300031867 Open in IMG/M
Scaffold IDGa0326511_10884523 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from UC Davis, California, United States - 0_2496_0518
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)878
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5357Long. (o)-121.7593Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068342Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0326511_108845231F068342N/AKISNFELLFLKRNEQKNTSTPEMKCHIKYIVLKDRNNTKITFERKDINEKYSIKTNSTQDMDNLISTLNLEQEKYKSFIKEYYGDNNSYNLIEGDSFMEYFADIKNFLESFSQSLEKIFMNVELQKLLDLISTLIEKCDYYLEVINQNENKIKELGEDIYLESKEIKELLSNLKQAVNNCSFGLNKNEIKEYVVNFKNIVKEKVQEIHVLIDEIKYNLGNYLALKIEDDMIDDKNKIFESKEEELTKVLLENESLKIQNENLVNENLIISQFLNDNKNKKY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.