NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315909_10211774

Scaffold Ga0315909_10211774


Overview

Basic Information
Taxon OID3300031857 Open in IMG/M
Scaffold IDGa0315909_10211774 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1524
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.7464Long. (o)-83.3444Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000545Metagenome / Metatranscriptome1038Y
F002241Metagenome / Metatranscriptome579Y

Sequences

Protein IDFamilyRBSSequence
Ga0315909_102117742F002241AGGAGMGREEVSKPHSIRYIRQLMEWGFDKEFIAKDCGINIHSLEVRLNRAKKREQDGNQRTEPRIGSSESDS
Ga0315909_102117744F000545N/AMDAYWFRWALGLSEMKQDAHPFICSNCKLVTPHIELHKYDSTDIAEAPEEVWLVECQRCFMQRIIYPADRVTAKEDDIVRCDQCGKWKMKAAKCRICRLAAGLESISERYWTGGETLERPYNANL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.