Scaffold Ga0315909_10058018

Overview

Basic Information

• Taxon OID: 3300031857
• Scaffold ID: Ga0315909_10058018
• Source Dataset Name: Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3537
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Parachlamydiales → unclassified Parachlamydiales → Parachlamydiales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Lake Erie, Ohio
• Coordinates
  • Lat. (^o): 41.7464
  • Long. (^o): -83.3444
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063632	Metagenome	129	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0315909_100580187	F063632	GGA	VLLKMRNVVEFLGNFFQNNGHLRGALYFSIAALTPMAASFTEWSSEDGPKNVYEIIAVMLGALISGLTAVRAYLDTHLSKAKEANEKH