NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315909_10056657

Scaffold Ga0315909_10056657


Overview

Basic Information
Taxon OID3300031857 Open in IMG/M
Scaffold IDGa0315909_10056657 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3588
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Gaiavirus → Mycobacterium virus Gaia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.7464Long. (o)-83.3444Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024549Metagenome / Metatranscriptome205Y
F084151Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0315909_1005665711F024549GAGMYRLDTYYDGNLEYTFQFADALQAFEAFAKCYDVGFAKELATYNLSLPTGKMYTKNFNRIGLVSAK
Ga0315909_100566574F084151AGGAGMTIEYSIWQGSRLLSVGNTATDIKDVDKVISTLNDSEIANKIKFSANIMKVEVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.