NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315909_10031720

Scaffold Ga0315909_10031720


Overview

Basic Information
Taxon OID3300031857 Open in IMG/M
Scaffold IDGa0315909_10031720 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5112
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (33.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.7464Long. (o)-83.3444Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003786Metagenome / Metatranscriptome468N
F008078Metagenome / Metatranscriptome339Y
F049620Metagenome / Metatranscriptome146N
F049623Metagenome / Metatranscriptome146N

Sequences

Protein IDFamilyRBSSequence
Ga0315909_1003172011F008078N/AMTPKEKAKELFTHYHNLIQDIGGELGQEILVSILAKQCALFAAREVLKEKYKIKTANGYDEYYYWEEVEHEIESYEE
Ga0315909_100317204F049623N/AMNESIFAQMMMSCIRDMPEEEYKRIKHSSTLTDYYVKGKYPKATAIFEQCRAVQKLFLVTSDNYRTLLSSFRQERILVGHMAT
Ga0315909_100317208F049620N/AMTPEERDEKIVSILTKICINVLVKNLFDKNGVRVYEEVLHELNQLPVNEEEYTRCNHAHAFLHKTAIEYLQKTIVFNEEHRNK
Ga0315909_100317209F003786GGAMNLTKYQPHNQDEQAIIESRPNRIANIEPKDAFRNVLNVISSLFPLHGIDGDLTFYSTVTKEIVKTFGQIAANEIEIAFRLFAAQSLDLDDDVKFYGKANMHTIGKILNAYLIYRRKIIAAHDNEVAALRHNANMEEKARKTREELYANFPTMLKEFKGKDFTTVPLYWYDMCVQFNMIEYEEGEKRALWEEAQALALKEPPESMDLMRIRSHAKKIEQGNTRRAVVIAQQLAVWRKVLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.