NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315909_10005617

Scaffold Ga0315909_10005617


Overview

Basic Information
Taxon OID3300031857 Open in IMG/M
Scaffold IDGa0315909_10005617 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14308
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.7464Long. (o)-83.3444Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021287Metagenome / Metatranscriptome219Y
F043909Metagenome / Metatranscriptome155N

Sequences

Protein IDFamilyRBSSequence
Ga0315909_100056171F021287GGAMPNLTLITLTPPNFPLNYCPANYQQFANDIISGTQATFLSSIGNSFFNFGATVPSLNNQIYPWLDADGNWWVYQGGFWARKHPVDIGSNERRIFIGTTTELQTYDGGNTNAPSAYSGPMWEVDTNFAARFPVGVGAFAASGTVAVQGTTTSSGVAGEDKHTLITAEIPPHTHTVGANFALDIDAGGRTLFGSGTDFSSSLN
Ga0315909_1000561715F043909N/AMRDIIRELSIKALKRFANGGDGHADLLMQIEDLRKTLEIRTKEHEEHLTELREERDHWLALYDENKFAAEFLMSYAKNDVPLLKDQVDWEVGKIVLPQETGTYYFNPCIIQEDDGRITFFARRCRNKRENDEDVYIEKNDIVMFELSRDLRATKKALISLNSHYPNEQFEDPRVVRFGDKYGLSCCTFIPFKSYAHQGMFLLDKHFHNVARFDPLYGNNNAQAMVNDGHEKNWLWFVHDNAPHMIYSANPHKVVRFNGRLEKEEEYVTD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.