NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307410_11232064

Scaffold Ga0307410_11232064


Overview

Basic Information
Taxon OID3300031852 Open in IMG/M
Scaffold IDGa0307410_11232064 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)653
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012765Metagenome / Metatranscriptome277Y
F065522Metagenome127N

Sequences

Protein IDFamilyRBSSequence
Ga0307410_112320641F012765AGAAGMEELDLQRCKLQESADEMTRLQRLISAKDATIKELRASKKSIAQELEAARLAAKVAEETAATLKDQRDKAMDKAIRAGRILMRRPDVVVPEDIKADV
Ga0307410_112320642F065522N/AQISTLEEKHSRDQAELVQRCADFEEKYSQSQTELGQVSAALDDANALSSSLHAQLDSEKVTYKTVPCLVVLLLFAWFLKELTFARRKKSVSLLLLVTILTGCIVILAIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.