NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316031_103697

Scaffold Ga0316031_103697


Overview

Basic Information
Taxon OID3300031826 Open in IMG/M
Scaffold IDGa0316031_103697 Open in IMG/M
Source Dataset NameSpruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI3 metaT (Metagenome Metatranscriptome) (v2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)824
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameCzech Republic: South Bohemian Region
CoordinatesLat. (o)49.0431Long. (o)13.617Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057620Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0316031_1036971F057620N/AVLVAVFPDHSTAERLRTLLVKDGFPTDRVELTSSQELGQAKLVPRDTVGEKLAEYFRTLFQHAGIHGDERAVQLFSRAVLDGKAALAVHPRGDIETDRALEILNQGGPLELREADLENQTFEHAAAHEETELTWIGKVLAGPGAPDTTGTARLP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.