Scaffold Ga0316217_10011221

Overview

Basic Information

• Taxon OID: 3300031813
• Scaffold ID: Ga0316217_10011221
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7635
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.0411
  • Long. (^o): -89.6861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068582	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316217_100112212	F068582	N/A	MTTLYGIRTITEQSLLALFQANASMLPSVELVAGQTDAIRSLPIIIIHAESAQAHPDLGGTPNGNFAITVRIYVYSSADDSTLAQHRARVEATQAIMEDFATMQSLWQQGTLYFSQVISDDEGVADRRWGNVIQYSLVAVYPPQ