| Basic Information | |
|---|---|
| Taxon OID | 3300031806 Open in IMG/M |
| Scaffold ID | Ga0315306_10005211 Open in IMG/M |
| Source Dataset Name | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5724 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Freshwater Sediment Microbial Communities From Lake Towuti, South Sulawesi, Indonesia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Indonesia: South Sulawesi | |||||||
| Coordinates | Lat. (o) | -2.7726 | Long. (o) | 121.4938 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079544 | Metagenome | 115 | Y |
| F102444 | Metagenome / Metatranscriptome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315306_100052111 | F102444 | AGGA | MQISRDRKALSPIFASLLILAIITVLFIPIFIWSTGFTAKTQAFWEISGTMAAERIVIEEVNLRGGAISCTIYVRNIGKTAIIVDNVFISEPDGTLHTYQKPWFTTDFNSVVQGDLMTINIPDLLPFTPPGDTYIVKGDTYIVKVYTTRGVGDTYQVVA |
| Ga0315306_100052112 | F079544 | GAGG | LKRKISRGRRGLSTIYVSLLFLLIVFSLLILLFSTVFNYNYTVSEQMRIEHERSQEKITISGLKLDDSQTNVTHVFINNTGSITVKIRAIYVTNQTTTALLCDPSTYTDTLIEPAESLLIPLPHGITFEPNAKLIATTERGVKTSEYEGLLIFGPPKPKWKYDPNRFYIGPLMLQFNAFFYRKTSQNGVLDPNDPWHPGWTIPKGFGYCAWNITVMNIDDRNITINRYSSFTAVPVDTPSNELSWYLEPVNQTNYTQFLPSNETRDIIYIWSNPKTFPEEGGQNSATKMTLPECRCMVFLTFYGIFHEHDGTTTTYAQTIPFEAAITVE |
| ⦗Top⦘ |