Scaffold Ga0310121_10535591

Overview

Basic Information

• Taxon OID: 3300031801
• Scaffold ID: Ga0310121_10535591
• Source Dataset Name: Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 643
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 73.0038
  • Long. (^o): -140.0007
  • Depth (m): 486

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060652	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310121_105355911	F060652	N/A	EPYRAVMYGARQRPSHLICGLCPSITDTTFALRFPHMLIIHAILDHDVSLEDVAQARRVNAPSGTVVWRLPDRRELAVVWQVTDYQS