NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310121_10499739

Scaffold Ga0310121_10499739


Overview

Basic Information
Taxon OID3300031801 Open in IMG/M
Scaffold IDGa0310121_10499739 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)674
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → environmental samples → uncultured Mediterranean phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)73.0038Long. (o)-140.0007Alt. (m)Depth (m)486
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002166Metagenome / Metatranscriptome588N

Sequences

Protein IDFamilyRBSSequence
Ga0310121_104997391F002166AGGTGGMLNQLSFQKFKKTLTEFKEDSPRETAEFKKLSPAEKQAVKDIFTMLDNTKGEIISKIDGIIKQVAKKRNVKVSAIED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.