Scaffold Ga0315900_10726357

Overview

Basic Information

• Taxon OID: 3300031787
• Scaffold ID: Ga0315900_10726357
• Source Dataset Name: Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 698
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Lake Erie, Ohio
• Coordinates
  • Lat. (^o): 41.6898
  • Long. (^o): -83.2813
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024259	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315900_107263571	F024259	N/A	MILHYIPKDSLRQHWEYVRHGLEIVRSKGHTDYIAEDVYCDCYEQRSMLFIGIVDNKPVGFVVLQPIGNRLHVWAAWSLLNDET