| Basic Information | |
|---|---|
| Taxon OID | 3300031787 Open in IMG/M |
| Scaffold ID | Ga0315900_10687237 Open in IMG/M |
| Source Dataset Name | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 728 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Lake Erie, Ohio | |||||||
| Coordinates | Lat. (o) | 41.6898 | Long. (o) | -83.2813 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024768 | Metagenome / Metatranscriptome | 204 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315900_106872373 | F024768 | N/A | MDYETEIIDGHKAVVRHFFKPHEIQVGSRWARADGSKGYVTVEGLNSYGSTNPWYEVVYSWEENGMKKIWQKETFAFQCRYCLIVE |
| ⦗Top⦘ |