NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315899_10029234

Scaffold Ga0315899_10029234


Overview

Basic Information
Taxon OID3300031784 Open in IMG/M
Scaffold IDGa0315899_10029234 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5817
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (52.63%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.8268Long. (o)-83.1913Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000345Metagenome / Metatranscriptome1253Y
F000744Metagenome / Metatranscriptome909Y
F004898Metagenome / Metatranscriptome419Y

Sequences

Protein IDFamilyRBSSequence
Ga0315899_1002923410F004898GAGGMDLSELIEELREIEIYGSEPADWMGYLYDDDFWVPDHELAY
Ga0315899_1002923419F000744GGAMKITEATVNLNVHEMGVILSALQNLENADEHRIAREYGSVPALYDKLYSYWELMDRSQTGIRNDVVPSF
Ga0315899_100292343F000345AGGAGLELSLEKMTEPNELGKVLKEWWDSDAYKEMQKSHQEGLERAVGKYFMLSESDKLDMLQAICYIMCKAESEGTSHRGLQDALGVYPAGFWVSELMDVHNALWSYYHDKKQEKELQDDLDSLDDFIK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.