Scaffold Ga0315326_10630340

Overview

Basic Information

• Taxon OID: 3300031775
• Scaffold ID: Ga0315326_10630340
• Source Dataset Name: Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 680
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.7468
  • Long. (^o): -122.0193
  • Depth (m): 80

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051980	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315326_106303401	F051980	AGGAGG	MATYKGQSGAVLQPGNQINKLSGFNDEGVFGWPGVEAFELVGYVKVTNVAADKASYKSFNITVPSPDRRSGDRVRNDRTS