NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308401_1007588

Scaffold Ga0308401_1007588


Overview

Basic Information
Taxon OID3300031767 Open in IMG/M
Scaffold IDGa0308401_1007588 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2701
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035590Metagenome / Metatranscriptome171N
F042114Metagenome / Metatranscriptome158Y
F043791Metagenome / Metatranscriptome155N
F052993Metagenome / Metatranscriptome141N

Sequences

Protein IDFamilyRBSSequence
Ga0308401_10075882F042114N/AMDEITRVATLNEAFKAAQRRVPFLYQHSSWLALYQPIDSQRARLFIINSHRYPQLNEYANAMAEMAIFVAHAQPKRFEHNGWKCLQFDLERKTLQ
Ga0308401_10075884F043791AGGAGMIENVLIAGLATVYFAFVFTAKRGPFDFFAKIRAAARRIPVLGYHLSCPTCLSLSSGALLLALTFTPLAFLVHIMAVAGIVLALHGMAGYWHSKDDE
Ga0308401_10075885F052993AGGMSSLHQFKARAFQRVAKKFDLRCYAFSHRDNQWLVAIRGNIVILSPTLIPIAPDIVDIRKLGNEKDYELFLALTGIGVRQSLRYQLVATGNFVTLYPKYNHAIFARSNQHVYSTRWRRIALSHAQYLFRRVKQPPCMQIAEDVERGKLMVALNYVRLGSFYIFVNGIPIDYAYPFHEQCSPQVYFGERKMLMKDNVVPWLGRLERTQLLPLPTPPPTLEQVLDKNASLDYHDGHGQKEDYPGTD
Ga0308401_10075886F035590N/AMMGMDKKKIILEQIERLLDHYSRNERDFFYLSFDGLVTLTFSVDDDGIVTLEEASVDGRFAIDLNRI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.