NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315322_10293145

Scaffold Ga0315322_10293145


Overview

Basic Information
Taxon OID3300031766 Open in IMG/M
Scaffold IDGa0315322_10293145 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1114
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077952Metagenome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0315322_102931451F077952N/ADSGKVDGYETVLTKPDDLKPTREMLRRMKALGITDLHLCEHPAKSRRWGQLDRAQTKRTKTRKMTMADVAGDLAELEKEAAEKEENNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.