NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318554_10055312

Scaffold Ga0318554_10055312


Overview

Basic Information
Taxon OID3300031765 Open in IMG/M
Scaffold IDGa0318554_10055312 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2178
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020967Metagenome / Metatranscriptome221Y
F066242Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0318554_100553124F066242AGGGGGMIKWNEAVSDRADEDLMVRINREQDDEFCQKLRAALWAGKETCPIGVSTEPGTKRPILKLSTA
Ga0318554_100553126F020967GGAGGMANAEPQMPEHVEAAYRDAVDNILFLKRQQWLATNYVLLLYAAIFVISAYYFSRTDVARNWLG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.