NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326513_11094813

Scaffold Ga0326513_11094813


Overview

Basic Information
Taxon OID3300031760 Open in IMG/M
Scaffold IDGa0326513_11094813 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from UC Davis, California, United States - 2_2465_0518
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)700
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5357Long. (o)-121.7593Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068247Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0326513_110948132F068247N/AATCVMFDLHLKHDIVPFDEGGKYLRDSIKENSDKGLLKKEFAETRLLEIREYGLRLEKLRNDTIKLIEKSFNGIISAVKKRKTVLMSEIIDYFGEEKEKINADEKKWMENQKIAEKIVSLAKDSDDGKILKNAKFICDSLKELDEKPEFRETKLLNVVDSSLHLDEETTLSYEEILHYLSQYMEILEPNLLEFNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.