Scaffold Ga0326513_10698818

Overview

Basic Information

• Taxon OID: 3300031760
• Scaffold ID: Ga0326513_10698818
• Source Dataset Name: Bovine rumen microbial communities from UC Davis, California, United States - 2_2465_0518
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 911
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → unclassified Prevotella → Prevotella sp. E9-3 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.5357
  • Long. (^o): -121.7593

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059440	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326513_106988182	F059440	N/A	MKTRKEREAEFKAKIAELDAYVEKMNAKSYKTDEEMKELMKAMRQTNRYLRAIGAPESAMYDL