Scaffold Ga0316219_1024323

Overview

Basic Information

• Taxon OID: 3300031759
• Scaffold ID: Ga0316219_1024323
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2818
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.0411
  • Long. (^o): -89.6861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056624	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316219_10243232	F056624	AGGA	MTAPSDQLHELAEKCTLCREDVKDRLASFDRRLLALEIVVRGEDGHNGMKSQLSKLCDRFDQFEKKAIRLIAIGTALPGIVVAVLGVLKFFGKL