Scaffold Ga0307404_10488864

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307404_10488864

Scaffold Ga0307404_10488864

Overview

Basic Information
Taxon OID	3300031752 Open in IMG/M
Scaffold ID	Ga0307404_10488864 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	518
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location Name	Southern Ocean
Coordinates	Lat. (^o)	-63.4827	Long. (^o)	-51.5956	Alt. (m)		Depth (m)	40
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015174	Metatranscriptome	256	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307404_104888641	F015174	N/A	AEYTLLRVEAEARRLVGRCADMYFQSLNSIGAWAEMKRTGGYHYKSNSIVNATSAWLGFGKISLKVVHGRTHAGAKYLNFYVKHLGRAGFAVGGLLGEDDHTDAETPSGACAQHLSLLAQSEDLDNHGSDIAAVAEAEFD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.