NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318494_10231827

Scaffold Ga0318494_10231827


Overview

Basic Information
Taxon OID3300031751 Open in IMG/M
Scaffold IDGa0318494_10231827 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1056
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007126Metagenome / Metatranscriptome357Y
F029856Metagenome / Metatranscriptome187Y
F041370Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0318494_102318271F029856N/AAWADGYATAERALRRAGIGYFGLRAVLRVLSPAESDALLGVAAAASLDDDRALYRDTEWPVEQVEKFKPYSIASLYAFAQEGFASGRWSPI
Ga0318494_102318272F041370GGAGMTEHEQAVEPAMATSPYLSLRQAVRPAILAHYLLAGDQERAGKLAADCEDLLFLTRELLKAAGRVRILAAGPAPGTLEAGELAGHDTPAEAGTDGGRPAQLLDAYADAGLLWAKVVGSSLALAGALIASWPRSPRPYTRS
Ga0318494_102318274F007126AGGAGMAGVVNDIEALAEFRAHLIRFNHDLAENFATIQSHWRELGEVWRDDMYRLFGEALEEVTPGIALY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.