| Basic Information | |
|---|---|
| Taxon OID | 3300031750 Open in IMG/M |
| Scaffold ID | Ga0307389_11232481 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 501 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -51.9926 | Long. (o) | 2.0992 | Alt. (m) | Depth (m) | 50 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008292 | Metatranscriptome | 335 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307389_112324811 | F008292 | AGG | MTSTLFLALMVVSPIAGLGEANPGVQKVIQMLGDMSAKVKHDKNEEQVMFAEFETWCKMEIPSTQKSISKAAESIELLNAEITKLTTEAKVLGQEIGKLQGEVASFESEKKAATAQRAKDNAAYQAESTDFGESVDALDNAI |
| ⦗Top⦘ |