| Basic Information | |
|---|---|
| Taxon OID | 3300031749 Open in IMG/M |
| Scaffold ID | Ga0315298_1036537 Open in IMG/M |
| Source Dataset Name | Extremophilic microbial mat communities from Washburn Hot Springs, YNP, Wyoming, USA - WHS_1_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4178 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Microbial Mat → Extremophilic Microbial Mat Communities From Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F075463 | Metagenome | 119 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315298_10365375 | F075463 | GAGG | VGSQSSGQVQIKDQYAPANLLEYGPPLDPSQFISQFAQLMEYAFPELAGIIVLFLIGKGMERIFLGKDKEKDFIDALAEKVAEKLKEQR |
| ⦗Top⦘ |