Scaffold Ga0315298_1004200

Overview

Basic Information

• Taxon OID: 3300031749
• Scaffold ID: Ga0315298_1004200
• Source Dataset Name: Extremophilic microbial mat communities from Washburn Hot Springs, YNP, Wyoming, USA - WHS_1_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 21819
• Total Scaffold Genes: 21
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Microbial Mat → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052337	Metagenome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315298_10042001	F052337	N/A	PKGRMAGGIWGQTRNLDDWTLDPADLSKRRLGGPSRPWHPDMGTDTMFDIPVRNVQRETFNSQLLTG