Scaffold Ga0315293_10325745

Overview

Basic Information

• Taxon OID: 3300031746
• Scaffold ID: Ga0315293_10325745
• Source Dataset Name: Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1226
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces → unclassified Actinomyces → Actinomyces sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.5395
  • Long. (^o): -110.3891
  • Depth (m): 61

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091910	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315293_103257451	F091910	N/A	AGALAILNPRFPQQQLLDSFNQELDDLSSPSNGLFRVVNADLTYNGSDRQLDITSASTVIDLIDVRLKYLASDYPVLRGVRLSRDLPTADFASGFAITFDELSMAGTLRVRYKAPFVRASTTASDIQSVCLLPLTMEDIIEMGVMARMLAVREVKRNFIESQGDTRRSDEVPAGSISNSVTNILRLRRDRIIAEASKLARQYPLTIRV