Scaffold Ga0307382_10514502

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307382_10514502

Scaffold Ga0307382_10514502

Overview

Basic Information
Taxon OID	3300031743 Open in IMG/M
Scaffold ID	Ga0307382_10514502 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	549
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location Name	Atlantic Ocean
Coordinates	Lat. (^o)	-45.9539	Long. (^o)	6.2869	Alt. (m)		Depth (m)	35
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011060	Metagenome / Metatranscriptome	295	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307382_105145021	F011060	N/A	MARVLAVMLMALAFVQSGALESELGRPHGARRRARERALKAETDFDITKTGCAQLGGDKWFTDAHGELFQVKQDHCTITFDLKTSHGGTVQKGGIVRGTKVFVEPPFPEGEVLGPVVKFENGKMWERKW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.