Scaffold Ga0307395_10526539

Overview

Basic Information

• Taxon OID: 3300031742
• Scaffold ID: Ga0307395_10526539
• Source Dataset Name: Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 517
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -59.0467
  • Long. (^o): 0.0779
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002825	Metagenome / Metatranscriptome	527	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307395_105265391	F002825	N/A	FESMTKYDAEIAKCTEYYSKQCGAMEACRGQIAAANYIAANSRMLILDSQAVINLCEVQIPTRELELKQHILKCKHELNKLNTRLKIVLGDIAVMTMILEMTDCEKKLLQMKKMALLHCEDQCTKEKFIKFDHSELQQKVSQLQSVSRSTMKNTFSDLFEGIESLEAEEFLQ