NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307468_100033658

Scaffold Ga0307468_100033658


Overview

Basic Information
Taxon OID3300031740 Open in IMG/M
Scaffold IDGa0307468_100033658 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2480
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022606Metagenome / Metatranscriptome213Y
F046925Metagenome / Metatranscriptome150Y
F093548Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0307468_1000336582F022606N/AMTRSRRATVLLLVALTTGCATAAPQALSPQLEDHQRLANALHPRVRVYGGWAPEDNLGLVQTTPFWKGGFGGLEIWLRGDVVGTPCGQYVIAGLLALRDQTRPLANRGLVSEEAIRNLVSVGWTQQAAEAAMASCPGASVGAGGR
Ga0307468_1000336583F093548GGAGGLLDLDVVRFVIRRRLEDGLLPRGRMMRVHDTPGDGQMCDACGANITSDQMAMVGATLEGGTRPRHFHALCFRIWDNERHLLDRRTA
Ga0307468_1000336585F046925AGGAGMVVPGGRRATLHRDEASLMEQPAWACTRCSRVIGPEDTIMFGTSSLSHVDCRRPRVLSTEERALLFLHCYDHSVECAPCASSFRVSELGSDLRGHTNLCPHCRQDLTDRVRAHLHKCDMISEEVRRRAQAVRAASERLVKESREPGDAADVLRQEVETALQALKEAMQQSSPGNLESGSGPALR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.