Scaffold Ga0307516_10019796

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307516_10019796

Scaffold Ga0307516_10019796

Overview

Basic Information
Taxon OID	3300031730 Open in IMG/M
Scaffold ID	Ga0307516_10019796 Open in IMG/M
Source Dataset Name	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6960
Total Scaffold Genes	18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (61.11%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location Name	USA: Washington
Coordinates	Lat. (^o)	47.5302	Long. (^o)	-121.825	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044595	Metagenome	154	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307516_1001979615	F044595	N/A	MNGLVAFVRAAAAMKSFGGCTSALHLTRPAGYQLDRNEDQLHPGEGSA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.