Scaffold Ga0316578_10428373

Overview

Basic Information

• Taxon OID: 3300031728
• Scaffold ID: Ga0316578_10428373
• Source Dataset Name: Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 783
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location

• Location Name: USA: Alabama
• Coordinates
  • Lat. (^o): 30.2619
  • Long. (^o): -88.2383
  • Depth (m): 0 to .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032659	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316578_104283731	F032659	N/A	KTEDFDANRASAGNHRKPDPEAPEPKHEEKHFRETVLPSGKIEAETEQGRADVGDMPTAETLGSLARKVLSSSRHAESRELARAVLELLARWGRTK