NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316576_10716647

Scaffold Ga0316576_10716647


Overview

Basic Information
Taxon OID3300031727 Open in IMG/M
Scaffold IDGa0316576_10716647 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)724
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location
Location NameUSA: Alabama
CoordinatesLat. (o)30.2619Long. (o)-88.2383Alt. (m)Depth (m)0 to .02
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014321Metagenome264Y

Sequences

Protein IDFamilyRBSSequence
Ga0316576_107166471F014321N/AQIDTFLEARKPGAHLAEDYVPDDFVLMLGVDLVNYPKFPKAVADGVTFPKTALDIRQDLEFDSGADLADYSGPYRADLRFTDFSTEALAERFLPWSEAYLLVCIEGWVNEVTKRFGEATMREIEWAAWTDQTGPELDRMRAEFLPEGYDYEDPNARVPIEERLHTPVVYTGLFTPRPECAMLTKAELVRWFLGSHEYLLQCIEGWAAQIVVRTGLDDMFDIQYTLWGNTVLPRVKELKAQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.