NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316576_10321249

Scaffold Ga0316576_10321249


Overview

Basic Information
Taxon OID3300031727 Open in IMG/M
Scaffold IDGa0316576_10321249 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1155
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location
Location NameUSA: Alabama
CoordinatesLat. (o)30.2619Long. (o)-88.2383Alt. (m)Depth (m)0 to .02
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004633Metagenome / Metatranscriptome430Y
F054972Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0316576_103212491F004633GGGGGMKLLMATLAYVMIGVLLGWGILLAVKGQPWMLIVGFLAYAVAFAKLGCLPK
Ga0316576_103212492F054972N/AMRRLLKSVKTREYFGDGYWTPDPALAQDFPDAGKAIDTCLKHHLTDVELVLQLNAEPHDFCDTHLRLFDYGLTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.