Scaffold Ga0307476_10036386

Overview

Basic Information

• Taxon OID: 3300031715
• Scaffold ID: Ga0307476_10036386
• Source Dataset Name: Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3301
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location

• Location Name: USA: Indiana
• Coordinates
  • Lat. (^o): 39.0844
  • Long. (^o): -86.4705

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030262	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307476_100363863	F030262	GGA	VKLVTSPSRTLVATELKRIELHLDADPCFAAAAGGAVRCLAEFAGMPEDVCREFQEATIRACLEAFELRPTSSHVVEFCRFEDRVEVIVDPNAGTDAIRLSRSVNSHS