Basic Information | |
---|---|
Taxon OID | 3300031708 Open in IMG/M |
Scaffold ID | Ga0310686_112942549 Open in IMG/M |
Source Dataset Name | FICUS49499 Metagenome Czech Republic combined assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1206 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Czech Republic: South Bohemian Region | |||||||
Coordinates | Lat. (o) | 49.043 | Long. (o) | 13.6183 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F009171 | Metagenome / Metatranscriptome | 322 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0310686_1129425492 | F009171 | GGAG | MSRRLLPLFLAIMALATINVSVWAKNDSGDTITTNLKLTTTTNVGTTKLAAGDYKVIADGTKAKFQQGNKVVAEIPCTLKDFTGKIIETTFVIDHNQLTEIQVAGKTKAIEFSSGM |
⦗Top⦘ |