Scaffold Ga0310686_111240470

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310686_111240470

Scaffold Ga0310686_111240470

Overview

Basic Information
Taxon OID	3300031708 Open in IMG/M
Scaffold ID	Ga0310686_111240470 Open in IMG/M
Source Dataset Name	FICUS49499 Metagenome Czech Republic combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	502
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location Name	Czech Republic: South Bohemian Region
Coordinates	Lat. (^o)	49.043	Long. (^o)	13.6183	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021035	Metagenome / Metatranscriptome	220	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310686_1112404701	F021035	GAG	MMTAEGCRRRAAESLHVAEAATNPTTSASLRRLSDAWAALAAHIEKDPHTVRERNAAREQSHQTEPRKADNDTAQVADFLRERLQLSDSDEPKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.