NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310686_101837493

Scaffold Ga0310686_101837493


Overview

Basic Information
Taxon OID3300031708 Open in IMG/M
Scaffold IDGa0310686_101837493 Open in IMG/M
Source Dataset NameFICUS49499 Metagenome Czech Republic combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1433
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameCzech Republic: South Bohemian Region
CoordinatesLat. (o)49.043Long. (o)13.6183Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009475Metagenome / Metatranscriptome317Y

Sequences

Protein IDFamilyRBSSequence
Ga0310686_1018374931F009475N/AMDGVAPRVVHRKAAAALGPGFAAAGFERRVASAAAVWQRPAGPEFAVGWVQPTRSPDAFGWYGSRFIIEFRRGAPPRAGVLGPGFRFCQLLDDEGRERVRAVQNAVIRRLPPAPARVLRMLDDRARDGYMAQGRQVATAYGPDHDVWFRYRDERDLDAWFRLLPVLLPGVLEAVRLRLG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.