| Basic Information | |
|---|---|
| Taxon OID | 3300031708 Open in IMG/M |
| Scaffold ID | Ga0310686_101406434 Open in IMG/M |
| Source Dataset Name | FICUS49499 Metagenome Czech Republic combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2090 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Czech Republic: South Bohemian Region | |||||||
| Coordinates | Lat. (o) | 49.043 | Long. (o) | 13.6183 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014439 | Metagenome / Metatranscriptome | 263 | Y |
| F016589 | Metagenome / Metatranscriptome | 246 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310686_1014064342 | F014439 | AGGAG | MSVILTLTDVDPGGTQIYAFGTVHLSGNYPTGGDSVDWTQLIGQVAVRGESVESSMADPAFGPLQASFTVQGGTPNQYQMQQGAAANNWKMRGYTTGSSGAEFTGGSAYPTSATSDVITFSAQFRKLT |
| Ga0310686_1014064345 | F016589 | N/A | MIEILRETHEAPTDVARSLELAGGRNPFGEANYRAVWGWSRLDWIGGKWEDRDPVSGALVREVVELRREPKYAPHNRWHIERWMPAENYGSPAAWHGQTLEIVNGRNVAALGPYPSRGDYEHCFTLEGLRGEFVQLTPAVARHIARA |
| ⦗Top⦘ |