NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302120_10163565

Scaffold Ga0302120_10163565


Overview

Basic Information
Taxon OID3300031701 Open in IMG/M
Scaffold IDGa0302120_10163565 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)870
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)70.5467Long. (o)-122.9077Alt. (m)Depth (m)625
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036431Metagenome / Metatranscriptome170N

Sequences

Protein IDFamilyRBSSequence
Ga0302120_101635653F036431GAGGMARKPSSNRTMVATEMFGLDEFLRELRFAPAETKKAVKQGNKVIADKVVVEMKKRARVVFHAQQYATVLPSLRAVQGTVPKIKIGGARKAAVSRRKDRPASGELVLGVEFGARRRGPHTRQFPMAKRGGFVLFPTIHKMHGFIKKEYTDNIEKVLRKVAR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.