NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302120_10091146

Scaffold Ga0302120_10091146


Overview

Basic Information
Taxon OID3300031701 Open in IMG/M
Scaffold IDGa0302120_10091146 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1246
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)70.5467Long. (o)-122.9077Alt. (m)Depth (m)625
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020372Metagenome / Metatranscriptome224Y
F028526Metagenome / Metatranscriptome191Y

Sequences

Protein IDFamilyRBSSequence
Ga0302120_100911463F028526GAGMEDYLGPVGLKPDLFLKLTKRISNPEYTMNFMEDRNGRKAMFYNYKGPEFEEGECVLLKATIAEHRLDKYERGKPLTYLNRVTVLENRGTI
Ga0302120_100911464F020372N/AMTEENRIQIFINEKEIQYSHQNIVAAINAFLPYLTNDDLDEMMKTFVTLKEHRRQKEHLTMIEVKKHSWPYPNTINKNDTT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.