Scaffold Ga0316579_10529158

Overview

Basic Information

• Taxon OID: 3300031691
• Scaffold ID: Ga0316579_10529158
• Source Dataset Name: Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 570
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location

• Location Name: USA: Alabama
• Coordinates
  • Lat. (^o): 30.2619
  • Long. (^o): -88.2383
  • Depth (m): .05 to .07

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051241	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316579_105291583	F051241	N/A	SYPTPRYWDRLYQMLEEEAEKRGKTPPPPPLTHALDHDPTEAERVERLAEQLQWADRNKLLHRIQMFFEAMPSSGWNRL